PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00502.1.p
Common NameEUGRSUZ_B00502, LOC104419739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 359aa    MW: 39611.9 Da    PI: 6.5064
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00502.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv +++ +G+g+W++++   g+ R+ k+c++rw +yl
  Eucgr.B00502.1.p 14 KGPWTPEEDIILVSYIQDHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding48.81.6e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T  E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Eucgr.B00502.1.p  67 RGNFTDHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.223965IPR017930Myb domain
SuperFamilySSF466891.43E-2911108IPR009057Homeodomain-like
SMARTSM007176.5E-141363IPR001005SANT/Myb domain
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001672.05E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.05166116IPR017930Myb domain
SMARTSM007176.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1367112IPR001005SANT/Myb domain
CDDcd001671.68E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010468Biological Processregulation of gene expression
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ DHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLQ  120
PGLDGHGHEE FRSSSHSISK GQWERRLQTD IQMAKQALCE ALSLDKSSTS PLADSKPSDH  180
DGHNIDSGNG TRPSYPSTAS SCTYASNTEN IARLLEGWMK NSAKSAQATK SSPGPNHNAA  240
QDYSFNSFIP TSGSSSSEGA TTPDHHQGLE YSLLSFNSSV SDGSQSVASV PDEKPNLTPD  300
QGCVFQEENK PVLDQIHHQQ VPLTLLEKWL FDDGAIVAPQ DQEDQLNSMS LDEDTALF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C7e-25141164105C-Myb DNA-Binding Domain
1mse_C7e-25141164105C-Myb DNA-Binding Domain
1h8a_C8e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00502.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029800.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-125MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A059CZ210.0A0A059CZ21_EUCGR; Uncharacterized protein
STRINGVIT_17s0000g06190.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-102myb domain protein 96